Lineage for d1fo1a1 (1fo1 A:203-362)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21460Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 21488Superfamily c.10.2: L domain-like [52058] (5 families) (S)
  5. 21498Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
  6. 21499Protein mRNA export factor tap [52066] (1 species)
  7. 21500Species Human (Homo sapiens) [TaxId:9606] [52067] (2 PDB entries)
  8. 21501Domain d1fo1a1: 1fo1 A:203-362 [30869]
    Other proteins in same PDB: d1fo1a2

Details for d1fo1a1

PDB Entry: 1fo1 (more details), 2.9 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

SCOP Domain Sequences for d1fo1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo1a1 c.10.2.3 (A:203-362) mRNA export factor tap {Human (Homo sapiens)}
elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
dgnslcdtfrdqstyisairerfpkllrldghelpppiaf

SCOP Domain Coordinates for d1fo1a1:

Click to download the PDB-style file with coordinates for d1fo1a1.
(The format of our PDB-style files is described here.)

Timeline for d1fo1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fo1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fo1b1