Lineage for d4qw1t_ (4qw1 T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229077Domain d4qw1t_: 4qw1 T: [308658]
    Other proteins in same PDB: d4qw1a_, d4qw1c_, d4qw1e_, d4qw1g_, d4qw1i_, d4qw1j_, d4qw1k_, d4qw1l_, d4qw1n_, d4qw1o_, d4qw1q_, d4qw1s_, d4qw1u_, d4qw1w_, d4qw1x_, d4qw1y_, d4qw1z_
    automated match to d4g4sg_
    complexed with bo2, cl, mg; mutant

Details for d4qw1t_

PDB Entry: 4qw1 (more details), 2.9 Å

PDB Description: yCP beta5-A50V mutant in complex with bortezomib
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qw1t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw1t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qw1t_:

Click to download the PDB-style file with coordinates for d4qw1t_.
(The format of our PDB-style files is described here.)

Timeline for d4qw1t_: