SCOPe 2.02: Domain d1fs2c2: 1fs2 C:146-401

Lineage for d1fs2c2 (1fs2 C:146-401)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.1: RNI-like [52047] (3 families)
   regular structure consisting of similar repeats

5. Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein)
   this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain

6. Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52057] (4 PDB entries)

8. Domain d1fs2c2: 1fs2 C:146-401 [30865]
   Other proteins in same PDB: d1fs2a1, d1fs2b1, d1fs2b2, d1fs2c1, d1fs2d1, d1fs2d2

Details for d1fs2c2

PDB Entry: 1fs2, 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

PDB Compounds: (C:) skp2

SCOPe Domain Sequences for d1fs2c2:

Sequence; same for both SEQRES and ATOM records:

>d1fs2c2 c.10.1.3 (C:146-401) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}
eslwqtldefrvqhmdlsnsvievstlhgilsqcsklqnlsleglrlsdpivntlaknsn
lvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhvqvavahvsetitqlnls
gyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffqlnylqhlslsrcydiipe
tllelgeiptlktlqvfgivpdgtlqllkealphlqin

Timeline for d1fs2c2:

• d1fs2c2 first appeared (with stable ids) in SCOP 1.55
  
• d1fs2c2 appears in SCOPe 2.01
  
• d1fs2c2 appears in SCOPe 2.03
  
• d1fs2c2 appears in the current release, SCOPe 2.08