Lineage for d4qvyq_ (4qvy Q:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (108 PDB entries)
  8. 2554893Domain d4qvyq_: 4qvy Q: [308608]
    Other proteins in same PDB: d4qvya_, d4qvyb_, d4qvyd_, d4qvye_, d4qvyf_, d4qvyg_, d4qvyh_, d4qvyi_, d4qvyj_, d4qvyk_, d4qvyl_, d4qvym_, d4qvyn_, d4qvyo_, d4qvyp_, d4qvyr_, d4qvys_, d4qvyt_, d4qvyu_, d4qvyv_, d4qvyw_, d4qvyx_, d4qvyy_, d4qvyz_
    automated match to d4eu2a_
    complexed with bo2, cl, mg; mutant

Details for d4qvyq_

PDB Entry: 4qvy (more details), 2.51 Å

PDB Description: yCP beta5-A49T-mutant in complex with bortezomib
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qvyq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvyq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qvyq_:

Click to download the PDB-style file with coordinates for d4qvyq_.
(The format of our PDB-style files is described here.)

Timeline for d4qvyq_: