Lineage for d4qvwp_ (4qvw P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994011Domain d4qvwp_: 4qvw P: [308583]
    Other proteins in same PDB: d4qvwa_, d4qvwc1, d4qvwc2, d4qvwe_, d4qvwi_, d4qvwj_, d4qvwk_, d4qvwl_, d4qvwn_, d4qvwo_, d4qvwq1, d4qvwq2, d4qvws_, d4qvww_, d4qvwx_, d4qvwy_, d4qvwz_
    automated match to d1rypc_
    complexed with bo2, cl, mg; mutant

Details for d4qvwp_

PDB Entry: 4qvw (more details), 3 Å

PDB Description: yCP beta5-A49S-mutant in complex with bortezomib
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qvwp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvwp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qvwp_:

Click to download the PDB-style file with coordinates for d4qvwp_.
(The format of our PDB-style files is described here.)

Timeline for d4qvwp_: