| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (3 families) ![]() regular structure consisting of similar repeats |
| Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein) this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain |
| Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52057] (4 PDB entries) |
| Domain d1fqve2: 1fqv E:146-431 [30858] Other proteins in same PDB: d1fqva1, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvd1, d1fqvd2, d1fqve1, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvp1, d1fqvp2 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOP Domain Sequences for d1fqve2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqve2 c.10.1.3 (E:146-431) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}
eslwqtldltgknlhpdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvi
evstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtlls
scsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlv
hldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpd
gtlqllkealphlqincshfttiarptignkknqeiwgikcrltlq
Timeline for d1fqve2:
View in 3DDomains from other chains: (mouse over for more information) d1fqva1, d1fqva2, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |