Lineage for d4qvwj_ (4qvw J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (235 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2549766Domain d4qvwj_: 4qvw J: [308577]
    Other proteins in same PDB: d4qvwb_, d4qvwc_, d4qvwf_, d4qvwg_, d4qvwh_, d4qvwm_, d4qvwp_, d4qvwq_, d4qvwt_, d4qvwu_, d4qvwv_
    automated match to d4j70j_
    complexed with bo2, cl, mg; mutant

Details for d4qvwj_

PDB Entry: 4qvw (more details), 3 Å

PDB Description: yCP beta5-A49S-mutant in complex with bortezomib
PDB Compounds: (J:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4qvwj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvwj_ d.153.1.4 (J:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

SCOPe Domain Coordinates for d4qvwj_:

Click to download the PDB-style file with coordinates for d4qvwj_.
(The format of our PDB-style files is described here.)

Timeline for d4qvwj_: