Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qvwf_: 4qvw F: [308573] Other proteins in same PDB: d4qvwa_, d4qvwc1, d4qvwc2, d4qvwe_, d4qvwi_, d4qvwj_, d4qvwk_, d4qvwl_, d4qvwn_, d4qvwo_, d4qvwq1, d4qvwq2, d4qvws_, d4qvww_, d4qvwx_, d4qvwy_, d4qvwz_ automated match to d4g4sg_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qvw (more details), 3 Å
SCOPe Domain Sequences for d4qvwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qvwf_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d4qvwf_: