Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (3 families) regular structure consisting of similar repeats |
Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein) this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain |
Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52057] (4 PDB entries) |
Domain d1fqva2: 1fqv A:146-431 [30856] Other proteins in same PDB: d1fqva1, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvd1, d1fqvd2, d1fqve1, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvp1, d1fqvp2 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOPe Domain Sequences for d1fqva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqva2 c.10.1.3 (A:146-431) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} eslwqtldltgknlhpdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvi evstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtlls scsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlv hldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpd gtlqllkealphlqincshfttiarptignkknqeiwgikcrltlq
Timeline for d1fqva2:
View in 3D Domains from other chains: (mouse over for more information) d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |