Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d4qvvc_: 4qvv C: [308547] Other proteins in same PDB: d4qvva_, d4qvvb_, d4qvve_, d4qvvf_, d4qvvg_, d4qvvh_, d4qvvi_, d4qvvj_, d4qvvk_, d4qvvl_, d4qvvm_, d4qvvn_, d4qvvo_, d4qvvp_, d4qvvs_, d4qvvt_, d4qvvu_, d4qvvv_, d4qvvw_, d4qvvx_, d4qvvy_, d4qvvz_ automated match to d4eu2a_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qvv (more details), 2.8 Å
SCOPe Domain Sequences for d4qvvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qvvc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qvvc_: