Lineage for d4qvvc_ (4qvv C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230722Domain d4qvvc_: 4qvv C: [308547]
    Other proteins in same PDB: d4qvva_, d4qvvb_, d4qvve_, d4qvvf_, d4qvvg_, d4qvvh_, d4qvvi_, d4qvvj_, d4qvvk_, d4qvvl_, d4qvvm_, d4qvvn_, d4qvvo_, d4qvvp_, d4qvvs_, d4qvvt_, d4qvvu_, d4qvvv_, d4qvvw_, d4qvvx_, d4qvvy_, d4qvvz_
    automated match to d4eu2a_
    complexed with bo2, cl, mg; mutant

Details for d4qvvc_

PDB Entry: 4qvv (more details), 2.8 Å

PDB Description: yCP beta5-A49V mutant in complex with bortezomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qvvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvvc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qvvc_:

Click to download the PDB-style file with coordinates for d4qvvc_.
(The format of our PDB-style files is described here.)

Timeline for d4qvvc_: