Lineage for d4qvqp_ (4qvq P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993706Domain d4qvqp_: 4qvq P: [308535]
    Other proteins in same PDB: d4qvqa_, d4qvqc1, d4qvqc2, d4qvqd_, d4qvqe_, d4qvqg_, d4qvqi_, d4qvqj_, d4qvqk_, d4qvql_, d4qvqn_, d4qvqo_, d4qvqq1, d4qvqq2, d4qvqr_, d4qvqs_, d4qvqu_, d4qvqw_, d4qvqx_, d4qvqy_, d4qvqz_
    automated match to d1rypc_
    complexed with bo2, cl, mg; mutant

Details for d4qvqp_

PDB Entry: 4qvq (more details), 2.6 Å

PDB Description: yCP beta5-M45I mutant in complex with bortezomib
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qvqp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvqp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qvqp_:

Click to download the PDB-style file with coordinates for d4qvqp_.
(The format of our PDB-style files is described here.)

Timeline for d4qvqp_: