Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qvqp_: 4qvq P: [308535] Other proteins in same PDB: d4qvqa_, d4qvqc1, d4qvqc2, d4qvqd_, d4qvqe_, d4qvqg_, d4qvqi_, d4qvqj_, d4qvqk_, d4qvql_, d4qvqn_, d4qvqo_, d4qvqq1, d4qvqq2, d4qvqr_, d4qvqs_, d4qvqu_, d4qvqw_, d4qvqx_, d4qvqy_, d4qvqz_ automated match to d1rypc_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qvq (more details), 2.6 Å
SCOPe Domain Sequences for d4qvqp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qvqp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qvqp_:
View in 3D Domains from other chains: (mouse over for more information) d4qvqa_, d4qvqb_, d4qvqc1, d4qvqc2, d4qvqd_, d4qvqe_, d4qvqf_, d4qvqg_, d4qvqh_, d4qvqi_, d4qvqj_, d4qvqk_, d4qvql_, d4qvqm_, d4qvqn_, d4qvqo_, d4qvqq1, d4qvqq2, d4qvqr_, d4qvqs_, d4qvqt_, d4qvqu_, d4qvqv_, d4qvqw_, d4qvqx_, d4qvqy_, d4qvqz_ |