Lineage for d4qvpp_ (4qvp P:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 2552995Domain d4qvpp_: 4qvp P: [308511]
    Other proteins in same PDB: d4qvpa_, d4qvpc_, d4qvpd_, d4qvpe_, d4qvpg_, d4qvpi_, d4qvpj_, d4qvpk_, d4qvpl_, d4qvpn_, d4qvpo_, d4qvpq_, d4qvpr_, d4qvps_, d4qvpu_, d4qvpw_, d4qvpx_, d4qvpy_, d4qvpz_
    automated match to d1rypc_
    complexed with bo2, cl, mg; mutant

Details for d4qvpp_

PDB Entry: 4qvp (more details), 2.3 Å

PDB Description: yCP beta5-M45T mutant in complex with bortezomib
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qvpp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvpp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qvpp_:

Click to download the PDB-style file with coordinates for d4qvpp_.
(The format of our PDB-style files is described here.)

Timeline for d4qvpp_: