Lineage for d2bnh__ (2bnh -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21460Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 21461Superfamily c.10.1: RNI-like [52047] (3 families) (S)
  5. 21462Family c.10.1.1: Ribonuclease inhibitor [52048] (1 protein)
  6. 21463Protein Ribonuclease inhibitor [52049] (2 species)
  7. 21467Species Pig (Sus scrofa) [TaxId:9823] [52050] (2 PDB entries)
  8. 21468Domain d2bnh__: 2bnh - [30850]

Details for d2bnh__

PDB Entry: 2bnh (more details), 2.3 Å

PDB Description: porcine ribonuclease inhibitor

SCOP Domain Sequences for d2bnh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnh__ c.10.1.1 (-) Ribonuclease inhibitor {Pig (Sus scrofa)}
mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
gcaleqlvlydtywteevedrlqalegskpglrvis

SCOP Domain Coordinates for d2bnh__:

Click to download the PDB-style file with coordinates for d2bnh__.
(The format of our PDB-style files is described here.)

Timeline for d2bnh__: