| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) ![]() |
| Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
| Protein Ribosomal protein L32e [52044] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
PDB Entry: 1ffk (more details), 2.4 Å
SCOPe Domain Sequences for d1ffkv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkv_ c.9.2.1 (V:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
qargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgi
kgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavrinskvgarkreri
eeeaedagirvlnptyvevevse
Timeline for d1ffkv_:
View in 3DDomains from other chains: (mouse over for more information) d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ |