SCOP 1.61: Domain d1ffkv_: 1ffk V:

Lineage for d1ffkv_ (1ffk V:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (7 PDB entries)

8. Domain d1ffkv_: 1ffk V: [30849]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffkv_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkv_:

Sequence; same for both SEQRES and ATOM records:

>d1ffkv_ c.9.2.1 (V:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
qargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgi
kgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavrinskvgarkreri
eeeaedagirvlnptyvevevse

Timeline for d1ffkv_:

• d1ffkv_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffkv_ appears in SCOP 1.59
  
• d1ffkv_ appears in SCOP 1.63
  
• d1ffkv_ appears in the current release, SCOPe 2.08