Lineage for d1ffkv_ (1ffk V:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21426Fold c.9: Barstar-like [52037] (2 superfamilies)
  4. 21455Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 21456Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
  6. 21457Protein Ribosomal protein L32e [52044] (1 species)
  7. 21458Species Haloarcula marismortui [TaxId:2238] [52045] (1 PDB entry)
  8. 21459Domain d1ffkv_: 1ffk V: [30849]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffkv_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkv_ c.9.2.1 (V:) Ribosomal protein L32e {Haloarcula marismortui}
qargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgi
kgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavrinskvgarkreri
eeeaedagirvlnptyvevevse

SCOP Domain Coordinates for d1ffkv_:

Click to download the PDB-style file with coordinates for d1ffkv_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkv_: