Lineage for d4qvnf_ (4qvn F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993829Domain d4qvnf_: 4qvn F: [308477]
    Other proteins in same PDB: d4qvna_, d4qvnc1, d4qvnc2, d4qvnd_, d4qvne_, d4qvng_, d4qvni_, d4qvnj_, d4qvnk_, d4qvnl_, d4qvnn_, d4qvno_, d4qvnq1, d4qvnq2, d4qvnr_, d4qvns_, d4qvnu_, d4qvnw_, d4qvnx_, d4qvny_, d4qvnz_
    automated match to d4g4sg_
    complexed with bo2, cl, mg; mutant

Details for d4qvnf_

PDB Entry: 4qvn (more details), 2.9 Å

PDB Description: yCP beta5-M45V mutant in complex with bortezomib
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qvnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvnf_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qvnf_:

Click to download the PDB-style file with coordinates for d4qvnf_.
(The format of our PDB-style files is described here.)

Timeline for d4qvnf_: