Lineage for d4qvlm_ (4qvl M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993817Domain d4qvlm_: 4qvl M: [308436]
    Other proteins in same PDB: d4qvla_, d4qvlc1, d4qvlc2, d4qvld_, d4qvle_, d4qvlg_, d4qvli_, d4qvlj_, d4qvlk_, d4qvll_, d4qvln_, d4qvlo_, d4qvlq1, d4qvlq2, d4qvlr_, d4qvls_, d4qvlu_, d4qvlw_, d4qvlx_, d4qvly_, d4qvlz_
    automated match to d4j70m_
    complexed with bo2, cl, mg

Details for d4qvlm_

PDB Entry: 4qvl (more details), 2.8 Å

PDB Description: yCP in complex with bortezomib
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4qvlm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvlm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d4qvlm_:

Click to download the PDB-style file with coordinates for d4qvlm_.
(The format of our PDB-style files is described here.)

Timeline for d4qvlm_: