Lineage for d4qvlc_ (4qvl C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (108 PDB entries)
  8. 2554928Domain d4qvlc_: 4qvl C: [308427]
    Other proteins in same PDB: d4qvla_, d4qvlb_, d4qvld_, d4qvle_, d4qvlf_, d4qvlg_, d4qvlh_, d4qvli_, d4qvlj_, d4qvlk_, d4qvll_, d4qvlm_, d4qvln_, d4qvlo_, d4qvlp_, d4qvlr_, d4qvls_, d4qvlt_, d4qvlu_, d4qvlv_, d4qvlw_, d4qvlx_, d4qvly_, d4qvlz_
    automated match to d4eu2a_
    complexed with bo2, cl, mg

Details for d4qvlc_

PDB Entry: 4qvl (more details), 2.8 Å

PDB Description: yCP in complex with bortezomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qvlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvlc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qvlc_:

Click to download the PDB-style file with coordinates for d4qvlc_.
(The format of our PDB-style files is described here.)

Timeline for d4qvlc_: