SCOPe 2.08: Domain d4qv8q1: 4qv8 Q:1-234

Lineage for d4qv8q1 (4qv8 Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4qv8q1: 4qv8 Q:1-234 [308392]
   Other proteins in same PDB: d4qv8a_, d4qv8b_, d4qv8c2, d4qv8d_, d4qv8e_, d4qv8f_, d4qv8g_, d4qv8h_, d4qv8i_, d4qv8j_, d4qv8k_, d4qv8l_, d4qv8m_, d4qv8n_, d4qv8o_, d4qv8p_, d4qv8q2, d4qv8r_, d4qv8s_, d4qv8t_, d4qv8u_, d4qv8v_, d4qv8w_, d4qv8x_, d4qv8y_, d4qv8z_
   automated match to d4eu2a_
   complexed with cl, mg; mutant

Details for d4qv8q1

PDB Entry: 4qv8, 2.9 Å

PDB Description: yCP beta5-C52F mutant

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qv8q1:

Sequence; same for both SEQRES and ATOM records:

>d4qv8q1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4qv8q1:

• d4qv8q1 first appeared in SCOPe 2.06, called d4qv8q_
  
• d4qv8q1 was called d4qv8q_ in SCOPe 2.07