Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qv8b_: 4qv8 B: [308378] Other proteins in same PDB: d4qv8a_, d4qv8c1, d4qv8c2, d4qv8d_, d4qv8e_, d4qv8g_, d4qv8i_, d4qv8j_, d4qv8k_, d4qv8l_, d4qv8n_, d4qv8o_, d4qv8q1, d4qv8q2, d4qv8r_, d4qv8s_, d4qv8u_, d4qv8w_, d4qv8x_, d4qv8y_, d4qv8z_ automated match to d1rypc_ complexed with cl, mg; mutant |
PDB Entry: 4qv8 (more details), 2.9 Å
SCOPe Domain Sequences for d4qv8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv8b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qv8b_:
View in 3D Domains from other chains: (mouse over for more information) d4qv8a_, d4qv8c1, d4qv8c2, d4qv8d_, d4qv8e_, d4qv8f_, d4qv8g_, d4qv8h_, d4qv8i_, d4qv8j_, d4qv8k_, d4qv8l_, d4qv8m_, d4qv8n_, d4qv8o_, d4qv8p_, d4qv8q1, d4qv8q2, d4qv8r_, d4qv8s_, d4qv8t_, d4qv8u_, d4qv8v_, d4qv8w_, d4qv8x_, d4qv8y_, d4qv8z_ |