SCOPe 2.08: Domain d4qv7l_: 4qv7 L:

Lineage for d4qv7l_ (4qv7 L:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qv7l_: 4qv7 L: [308363]
   Other proteins in same PDB: d4qv7b_, d4qv7c1, d4qv7c2, d4qv7d_, d4qv7e_, d4qv7f_, d4qv7g_, d4qv7h_, d4qv7k_, d4qv7m_, d4qv7p_, d4qv7q1, d4qv7q2, d4qv7r_, d4qv7s_, d4qv7t_, d4qv7u_, d4qv7v_, d4qv7y_
   automated match to d1rypm_
   complexed with cl, mg; mutant

Details for d4qv7l_

PDB Entry: 4qv7, 2.6 Å

PDB Description: yCP beta5-A50V mutant

PDB Compounds: (L:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d4qv7l_:

Sequence; same for both SEQRES and ATOM records:

>d4qv7l_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

Timeline for d4qv7l_:

• d4qv7l_ first appeared in SCOPe 2.06
  
• d4qv7l_ appears in SCOPe 2.07