Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4qv7b_: 4qv7 B: [308354] Other proteins in same PDB: d4qv7a_, d4qv7c_, d4qv7e_, d4qv7g_, d4qv7i_, d4qv7j_, d4qv7k_, d4qv7l_, d4qv7n_, d4qv7o_, d4qv7q_, d4qv7s_, d4qv7u_, d4qv7w_, d4qv7x_, d4qv7y_, d4qv7z_ automated match to d1rypc_ complexed with cl, mg; mutant |
PDB Entry: 4qv7 (more details), 2.6 Å
SCOPe Domain Sequences for d4qv7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv7b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qv7b_: