Lineage for d4qv6v_ (4qv6 V:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229128Domain d4qv6v_: 4qv6 V: [308348]
    Other proteins in same PDB: d4qv6a_, d4qv6c_, d4qv6e_, d4qv6g_, d4qv6i_, d4qv6j_, d4qv6k_, d4qv6l_, d4qv6n_, d4qv6o_, d4qv6q_, d4qv6s_, d4qv6u_, d4qv6w_, d4qv6x_, d4qv6y_, d4qv6z_
    automated match to d4r17h_
    complexed with cl, mg; mutant

Details for d4qv6v_

PDB Entry: 4qv6 (more details), 2.8 Å

PDB Description: yCP beta5-A49V mutant
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qv6v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv6v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d4qv6v_:

Click to download the PDB-style file with coordinates for d4qv6v_.
(The format of our PDB-style files is described here.)

Timeline for d4qv6v_: