Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d4qv6c_: 4qv6 C: [308331] Other proteins in same PDB: d4qv6a_, d4qv6b_, d4qv6e_, d4qv6f_, d4qv6g_, d4qv6h_, d4qv6i_, d4qv6j_, d4qv6k_, d4qv6l_, d4qv6m_, d4qv6n_, d4qv6o_, d4qv6p_, d4qv6s_, d4qv6t_, d4qv6u_, d4qv6v_, d4qv6w_, d4qv6x_, d4qv6y_, d4qv6z_ automated match to d4eu2a_ complexed with cl, mg; mutant |
PDB Entry: 4qv6 (more details), 2.8 Å
SCOPe Domain Sequences for d4qv6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv6c_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qv6c_: