Lineage for d4qv5t_ (4qv5 T:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 2553117Domain d4qv5t_: 4qv5 T: [308322]
    Other proteins in same PDB: d4qv5a_, d4qv5c_, d4qv5d_, d4qv5e_, d4qv5g_, d4qv5i_, d4qv5j_, d4qv5k_, d4qv5l_, d4qv5n_, d4qv5o_, d4qv5q_, d4qv5r_, d4qv5s_, d4qv5u_, d4qv5w_, d4qv5x_, d4qv5y_, d4qv5z_
    automated match to d4g4sg_
    complexed with cl, mg; mutant

Details for d4qv5t_

PDB Entry: 4qv5 (more details), 2.7 Å

PDB Description: yCP beta5-M45I mutant
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qv5t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv5t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qv5t_:

Click to download the PDB-style file with coordinates for d4qv5t_.
(The format of our PDB-style files is described here.)

Timeline for d4qv5t_: