Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qv5b_: 4qv5 B: [308306] Other proteins in same PDB: d4qv5a_, d4qv5c1, d4qv5c2, d4qv5d_, d4qv5e_, d4qv5g_, d4qv5i_, d4qv5j_, d4qv5k_, d4qv5l_, d4qv5n_, d4qv5o_, d4qv5q1, d4qv5q2, d4qv5r_, d4qv5s_, d4qv5u_, d4qv5w_, d4qv5x_, d4qv5y_, d4qv5z_ automated match to d1rypc_ complexed with cl, mg; mutant |
PDB Entry: 4qv5 (more details), 2.7 Å
SCOPe Domain Sequences for d4qv5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv5b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qv5b_:
View in 3D Domains from other chains: (mouse over for more information) d4qv5a_, d4qv5c1, d4qv5c2, d4qv5d_, d4qv5e_, d4qv5f_, d4qv5g_, d4qv5h_, d4qv5i_, d4qv5j_, d4qv5k_, d4qv5l_, d4qv5m_, d4qv5n_, d4qv5o_, d4qv5p_, d4qv5q1, d4qv5q2, d4qv5r_, d4qv5s_, d4qv5t_, d4qv5u_, d4qv5v_, d4qv5w_, d4qv5x_, d4qv5y_, d4qv5z_ |