Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4qv3p_: 4qv3 P: [308271] Other proteins in same PDB: d4qv3a_, d4qv3c_, d4qv3e_, d4qv3i_, d4qv3j_, d4qv3k_, d4qv3l_, d4qv3n_, d4qv3o_, d4qv3q_, d4qv3s_, d4qv3w_, d4qv3x_, d4qv3y_, d4qv3z_ automated match to d1rypc_ complexed with cl, mg; mutant |
PDB Entry: 4qv3 (more details), 3 Å
SCOPe Domain Sequences for d4qv3p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv3p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qv3p_: