Lineage for d4qv1t_ (4qv1 T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228737Domain d4qv1t_: 4qv1 T: [308250]
    Other proteins in same PDB: d4qv1a_, d4qv1c_, d4qv1e_, d4qv1g_, d4qv1i_, d4qv1j_, d4qv1k_, d4qv1l_, d4qv1n_, d4qv1o_, d4qv1q_, d4qv1s_, d4qv1u_, d4qv1w_, d4qv1x_, d4qv1y_, d4qv1z_
    automated match to d4g4sg_
    complexed with cl, mg; mutant

Details for d4qv1t_

PDB Entry: 4qv1 (more details), 2.5 Å

PDB Description: yCP beta5-M45A mutant
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qv1t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv1t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qv1t_:

Click to download the PDB-style file with coordinates for d4qv1t_.
(The format of our PDB-style files is described here.)

Timeline for d4qv1t_: