Lineage for d4qv0u_ (4qv0 U:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 2553327Domain d4qv0u_: 4qv0 U: [308227]
    Other proteins in same PDB: d4qv0a_, d4qv0c_, d4qv0e_, d4qv0i_, d4qv0j_, d4qv0k_, d4qv0l_, d4qv0n_, d4qv0o_, d4qv0q_, d4qv0s_, d4qv0w_, d4qv0x_, d4qv0y_, d4qv0z_
    automated match to d1rypa_
    complexed with cl, mg; mutant

Details for d4qv0u_

PDB Entry: 4qv0 (more details), 3.1 Å

PDB Description: ycp beta5-a49t-a50v-double mutant
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4qv0u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv0u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4qv0u_:

Click to download the PDB-style file with coordinates for d4qv0u_.
(The format of our PDB-style files is described here.)

Timeline for d4qv0u_: