Lineage for d4qv0t_ (4qv0 T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2995027Domain d4qv0t_: 4qv0 T: [308226]
    Other proteins in same PDB: d4qv0a_, d4qv0c1, d4qv0c2, d4qv0e_, d4qv0i_, d4qv0j_, d4qv0k_, d4qv0l_, d4qv0n_, d4qv0o_, d4qv0q1, d4qv0q2, d4qv0s_, d4qv0w_, d4qv0x_, d4qv0y_, d4qv0z_
    automated match to d4g4sg_
    complexed with cl, mg; mutant

Details for d4qv0t_

PDB Entry: 4qv0 (more details), 3.1 Å

PDB Description: ycp beta5-a49t-a50v-double mutant
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qv0t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv0t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qv0t_:

Click to download the PDB-style file with coordinates for d4qv0t_.
(The format of our PDB-style files is described here.)

Timeline for d4qv0t_: