Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) |
Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein) |
Protein Thermosome, A-domain [52035] (4 species) |
Species Archaeon Thermoplasma acidophilum, alpha chain [TaxId:2303] [100946] (4 PDB entries) |
Domain d1a6ea2: 1a6e A:215-367 [30822] Other proteins in same PDB: d1a6ea1, d1a6ea3, d1a6eb1, d1a6eb3 complexed with adp, af3, mg |
PDB Entry: 1a6e (more details), 3.2 Å
SCOP Domain Sequences for d1a6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6ea2 c.8.5.2 (A:215-367) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, alpha chain} gividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetntfk qmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtdld dltpsvlgeaetveerkigddrmtfvmgcknpk
Timeline for d1a6ea2: