SCOP 1.65: Domain d1asx__: 1asx -

Lineage for d1asx__ (1asx -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in all proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)

6. Protein Thermosome, A-domain [52035] (2 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [52036] (5 PDB entries)

8. Domain d1asx__: 1asx - [30821]
   alpha-subunit apical domain only
   complexed with po4

Details for d1asx__

PDB Entry: 1asx, 2.8 Å

PDB Description: apical domain of the chaperonin from thermoplasma acidophilum

SCOP Domain Sequences for d1asx__:

Sequence; same for both SEQRES and ATOM records:

>d1asx__ c.8.5.2 (-) Thermosome, A-domain {Archaeon Thermoplasma acidophilum}
msgividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetnt
fkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtd
lddltpsvlgeaetveerkigddrmtfvmgck

Timeline for d1asx__:

• d1asx__ first appeared (with stable ids) in SCOP 1.55
  
• d1asx__ appears in SCOP 1.63
  
• d1asx__ appears in SCOP 1.67
  
• d1asx__ appears in the current release, SCOPe 2.08, called d1asxa_