| Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) ![]() |
| Family c.8.5.2: Group II chaperonin (CCT, TRIC) [52034] (1 protein) |
| Protein Thermosome [52035] (1 species) |
| Species Archaeon Thermoplasma acidophilum [TaxId:2303] [52036] (5 PDB entries) |
| Domain d1a6db2: 1a6d B:216-367 [30820] Other proteins in same PDB: d1a6da1, d1a6da3, d1a6db1, d1a6db3 |
PDB Entry: 1a6d (more details), 2.6 Å
SCOP Domain Sequences for d1a6db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6db2 c.8.5.2 (B:216-367) Thermosome {Archaeon Thermoplasma acidophilum}
giivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenmlr
emvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivstid
eisssdlgtaerveqvkvgedymtfvtgcknp
Timeline for d1a6db2: