Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4quyh_: 4quy H: [308191] Other proteins in same PDB: d4quya_, d4quyc_, d4quye_, d4quyg_, d4quyi_, d4quyj_, d4quyk_, d4quyl_, d4quyn_, d4quyo_, d4quyq_, d4quys_, d4quyu_, d4quyw_, d4quyx_, d4quyy_, d4quyz_ automated match to d4r17h_ complexed with cl, mg; mutant |
PDB Entry: 4quy (more details), 2.8 Å
SCOPe Domain Sequences for d4quyh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4quyh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d4quyh_: