Lineage for d4quyh_ (4quy H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229001Domain d4quyh_: 4quy H: [308191]
    Other proteins in same PDB: d4quya_, d4quyc_, d4quye_, d4quyg_, d4quyi_, d4quyj_, d4quyk_, d4quyl_, d4quyn_, d4quyo_, d4quyq_, d4quys_, d4quyu_, d4quyw_, d4quyx_, d4quyy_, d4quyz_
    automated match to d4r17h_
    complexed with cl, mg; mutant

Details for d4quyh_

PDB Entry: 4quy (more details), 2.8 Å

PDB Description: yCP beta5-A49S-mutant
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4quyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quyh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d4quyh_:

Click to download the PDB-style file with coordinates for d4quyh_.
(The format of our PDB-style files is described here.)

Timeline for d4quyh_: