Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) |
Family c.8.5.1: GroEL [52030] (1 protein) |
Protein GroEL [52031] (2 species) |
Species Thermus thermophilus [TaxId:274] [52033] (1 PDB entry) |
Domain d1srva_: 1srv A: [30817] |
PDB Entry: 1srv (more details), 1.7 Å
SCOP Domain Sequences for d1srva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1srva_ c.8.5.1 (A:) GroEL {Thermus thermophilus} gyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkplliia edvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfklen atlsmlgraervritkdettivggk
Timeline for d1srva_: