Lineage for d1srva_ (1srv A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67590Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 67680Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 67681Family c.8.5.1: GroEL [52030] (1 protein)
  6. 67682Protein GroEL [52031] (2 species)
  7. 67730Species Thermus thermophilus [TaxId:274] [52033] (1 PDB entry)
  8. 67731Domain d1srva_: 1srv A: [30817]

Details for d1srva_

PDB Entry: 1srv (more details), 1.7 Å

PDB Description: thermus thermophilus groel (hsp60 class) fragment (apical domain) comprising residues 192-336

SCOP Domain Sequences for d1srva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srva_ c.8.5.1 (A:) GroEL {Thermus thermophilus}
gyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkplliia
edvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfklen
atlsmlgraervritkdettivggk

SCOP Domain Coordinates for d1srva_:

Click to download the PDB-style file with coordinates for d1srva_.
(The format of our PDB-style files is described here.)

Timeline for d1srva_: