Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) |
Family c.8.5.1: GroEL [52030] (1 protein) |
Protein GroEL [52031] (3 species) |
Species Escherichia coli [TaxId:562] [52032] (11 PDB entries) |
Domain d1grl_2: 1grl 191-366 [30816] Other proteins in same PDB: d1grl_1, d1grl_3 |
PDB Entry: 1grl (more details), 2.8 Å
SCOP Domain Sequences for d1grl_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grl_2 c.8.5.1 (191-366) GroEL {Escherichia coli} egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii aedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1grl_2: