Lineage for d1grl_2 (1grl 191-366)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119570Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 119667Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 119668Family c.8.5.1: GroEL [52030] (1 protein)
  6. 119669Protein GroEL [52031] (3 species)
  7. 119670Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 119716Domain d1grl_2: 1grl 191-366 [30816]
    Other proteins in same PDB: d1grl_1, d1grl_3

Details for d1grl_2

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms

SCOP Domain Sequences for d1grl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grl_2 c.8.5.1 (191-366) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1grl_2:

Click to download the PDB-style file with coordinates for d1grl_2.
(The format of our PDB-style files is described here.)

Timeline for d1grl_2: