Lineage for d1aonl2 (1aon L:191-366)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389637Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 389744Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 389745Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 389746Protein GroEL, A domain [52031] (3 species)
  7. 389747Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 389805Domain d1aonl2: 1aon L:191-366 [30813]
    Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonl2

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonl2 c.8.5.1 (L:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1aonl2:

Click to download the PDB-style file with coordinates for d1aonl2.
(The format of our PDB-style files is described here.)

Timeline for d1aonl2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_