Lineage for d1aonl2 (1aon L:191-366)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119570Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 119667Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 119668Family c.8.5.1: GroEL [52030] (1 protein)
  6. 119669Protein GroEL [52031] (3 species)
  7. 119670Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 119713Domain d1aonl2: 1aon L:191-366 [30813]
    Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonl2

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonl2 c.8.5.1 (L:191-366) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1aonl2:

Click to download the PDB-style file with coordinates for d1aonl2.
(The format of our PDB-style files is described here.)

Timeline for d1aonl2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_