SCOPe 2.08: Domain d1aonk2: 1aon K:191-366

Lineage for d1aonk2 (1aon K:191-366)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)

8. Domain d1aonk2: 1aon K:191-366 [30812]
   Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_
   complexed with adp, mg

Details for d1aonk2

PDB Entry: 1aon, 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

PDB Compounds: (K:) groEL

SCOPe Domain Sequences for d1aonk2:

Sequence; same for both SEQRES and ATOM records:

>d1aonk2 c.8.5.1 (K:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

Timeline for d1aonk2:

• d1aonk2 first appeared (with stable ids) in SCOP 1.55
  
• d1aonk2 appears in SCOPe 2.07