Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries) |
Domain d4q1xa_: 4q1x A: [308066] automated match to d3ekya_ complexed with 017, gol, po4; mutant |
PDB Entry: 4q1x (more details), 1.9 Å
SCOPe Domain Sequences for d4q1xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q1xa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwkrplvtiriggqlkealldtgaddtileemnlpgkwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d4q1xa_: