SCOPe 2.08: Domain d4pzdb1: 4pzd B:2-185

Lineage for d4pzdb1 (4pzd B:2-185)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [229715] (8 PDB entries)

8. Domain d4pzdb1: 4pzd B:2-185 [308042]
   Other proteins in same PDB: d4pzda2, d4pzdb2, d4pzdc2, d4pzdd2, d4pzde2, d4pzdf2, d4pzdg2, d4pzdh2, d4pzdi2
   automated match to d4pzea1
   complexed with nad

Details for d4pzdb1

PDB Entry: 4pzd, 2.61 Å

PDB Description: Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 in complex with NAD+

PDB Compounds: (B:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzdb1:

Sequence; same for both SEQRES and ATOM records:

>d4pzdb1 c.2.1.0 (B:2-185) automated matches {Ralstonia eutropha [TaxId: 381666]}
sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
knsp

Timeline for d4pzdb1:

• d4pzdb1 first appeared in SCOPe 2.06
  
• d4pzdb1 appears in SCOPe 2.07