![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) ![]() |
![]() | Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein) |
![]() | Protein GroEL, A domain [52031] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [52032] (16 PDB entries) |
![]() | Domain d1aonc2: 1aon C:191-366 [30804] Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_ |
PDB Entry: 1aon (more details), 3 Å
SCOP Domain Sequences for d1aonc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aonc2 c.8.5.1 (C:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]} egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1aonc2:
![]() Domains from other chains: (mouse over for more information) d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_ |