Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (35 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries) |
Domain d4pzcb2: 4pzc B:186-284 [308037] Other proteins in same PDB: d4pzca1, d4pzcb1, d4pzcc1 automated match to d4pzea2 |
PDB Entry: 4pzc (more details), 2.6 Å
SCOPe Domain Sequences for d4pzcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzcb2 a.100.1.0 (B:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]} gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme vlytefadpkyrpamlmremvaagylgrktgrgvyvysk
Timeline for d4pzcb2:
View in 3D Domains from other chains: (mouse over for more information) d4pzca1, d4pzca2, d4pzcc1, d4pzcc2 |