SCOPe 2.08: Domain d4pyge4: 4pyg E:586-687

Lineage for d4pyge4 (4pyg E:586-687)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families)
   automatically mapped to Pfam PF00927

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries)
   GDP-binding protein

8. Domain d4pyge4: 4pyg E:586-687 [308032]
   Other proteins in same PDB: d4pyga1, d4pyga2, d4pyga5, d4pygb1, d4pygb2, d4pygb5, d4pyge1, d4pyge2, d4pyge5
   automated match to d3ly6a4
   complexed with gtp

Details for d4pyge4

PDB Entry: 4pyg, 2.8 Å

PDB Description: Transglutaminase2 complexed with GTP

PDB Compounds: (E:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d4pyge4:

Sequence; same for both SEQRES and ATOM records:

>d4pyge4 b.1.5.1 (E:586-687) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag
eevkvrmdllplhmglhklvvnfesdklkavkgfrnviigpa

Timeline for d4pyge4:

• d4pyge4 first appeared in SCOPe 2.06
  
• d4pyge4 appears in SCOPe 2.07