Lineage for d4pyge3 (4pyg E:469-585)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037080Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2037081Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2037082Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2037155Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (4 PDB entries)
    GDP-binding protein
  8. 2037180Domain d4pyge3: 4pyg E:469-585 [308031]
    Other proteins in same PDB: d4pyga1, d4pyga2, d4pyga5, d4pygb1, d4pygb2, d4pygb5, d4pyge1, d4pyge2, d4pyge5
    automated match to d3ly6a3
    complexed with gtp

Details for d4pyge3

PDB Entry: 4pyg (more details), 2.8 Å

PDB Description: Transglutaminase2 complexed with GTP
PDB Compounds: (E:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d4pyge3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pyge3 b.1.5.1 (E:469-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
eetgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtky
llnlnlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle

SCOPe Domain Coordinates for d4pyge3:

Click to download the PDB-style file with coordinates for d4pyge3.
(The format of our PDB-style files is described here.)

Timeline for d4pyge3: