Lineage for d1aonb2 (1aon B:191-366)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. Protein GroEL, A domain [52031] (4 species)
  7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. Domain d1aonb2: 1aon B:191-366 [30803]
    Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_
    complexed with adp, mg

Details for d1aonb2

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7
PDB Compounds: (B:) groEL

SCOPe Domain Sequences for d1aonb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonb2 c.8.5.1 (B:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1aonb2 are not available.

Timeline for d1aonb2: