Lineage for d4prcl_ (4prc L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027283Protein L (light) subunit [81477] (4 species)
  7. 3027358Species Rhodopseudomonas viridis [TaxId:1079] [81474] (21 PDB entries)
  8. 3027364Domain d4prcl_: 4prc L: [308005]
    Other proteins in same PDB: d4prcc_, d4prch3, d4prch4, d4prch5, d4prcm_
    automated match to d6prcl_
    complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, sma, so4

Details for d4prcl_

PDB Entry: 4prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (stigmatellin complex)
PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d4prcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOPe Domain Coordinates for d4prcl_:

Click to download the PDB-style file with coordinates for d4prcl_.
(The format of our PDB-style files is described here.)

Timeline for d4prcl_: