SCOPe 2.06: Domain d4prch3: 4prc H:1-36

Lineage for d4prch3 (4prc H:1-36)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (19 PDB entries)
   synonym: blastochloris viridis

8. Domain d4prch3: 4prc H:1-36 [308003]
   Other proteins in same PDB: d4prcc_, d4prch4, d4prcl_, d4prcm_
   automated match to d6prch2
   complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, sma, so4

Details for d4prch3

PDB Entry: 4prc, 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (stigmatellin complex)

PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d4prch3:

Sequence; same for both SEQRES and ATOM records:

>d4prch3 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d4prch3:

• d4prch3 is new in SCOPe 2.06-stable
  
• d4prch3 appears in SCOPe 2.07
  
• d4prch3 appears in the current release, SCOPe 2.08